PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G388700.1.p
Common NameSb02g040480, SORBIDRAFT_02g040480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 382aa    MW: 40264.6 Da    PI: 7.2555
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G388700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEd++l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Sobic.002G388700.1.p 14 RGLWSPEEDDKLINHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                          788*******************************************97 PP

2Myb_DNA-binding51.72e-1667111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++++eE++l+++++ ++G++ W+ Ia  ++ gRt++++k++w++y
  Sobic.002G388700.1.p  67 RGAFSQEEEDLIIHLHSMMGNK-WSQIATQLP-GRTDNEVKNFWNSY 111
                           89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.993961IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-25964IPR009057Homeodomain-like
SuperFamilySSF466899.73E-3012108IPR009057Homeodomain-like
SMARTSM007175.1E-141363IPR001005SANT/Myb domain
PfamPF002498.7E-161461IPR001005SANT/Myb domain
CDDcd001671.60E-121761No hitNo description
PROSITE profilePS5129427.00862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2665116IPR009057Homeodomain-like
SMARTSM007177.2E-1666114IPR001005SANT/Myb domain
PfamPF002492.1E-1567111IPR001005SANT/Myb domain
CDDcd001673.69E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MARRTSGPKK KLRRGLWSPE EDDKLINHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIH LHSMMGNKWS QIATQLPGRT DNEVKNFWNS YIKKKLRQRG  120
IDPATHKPLP LAADASRAAA AGSSRTAVFS DAELILSSTT TAAAGQHMPP PPVTAAAAES  180
YDVYSNSYSR SSGGGGASDG SLQSLSGYKY NNSSKQTAAD HLGAAAAAGY LQDPAAADAL  240
CCGPSGVPAV VLPSVSSSST LNSMAGLSPA ATTTATDEQC NNNNNNCSSC NNGFELMSTT  300
PHSCCSNHHL PWLELGTSGY GGAASAGVVD HYGAALDELK WSDYVFDGYG GQPGQSIYGD  360
SKDAVQFVDA SALSSSSWCL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0340160.0BT034016.1 Zea mays full-length cDNA clone ZM_BFc0036C19 mRNA, complete cds.
GenBankBT0353990.0BT035399.1 Zea mays full-length cDNA clone ZM_BFb0059D04 mRNA, complete cds.
GenBankBT0409890.0BT040989.1 Zea mays full-length cDNA clone ZM_BFc0162L22 mRNA, complete cds.
GenBankBT0675250.0BT067525.1 Zea mays full-length cDNA clone ZM_BFc0072I17 mRNA, complete cds.
GenBankKJ7276140.0KJ727614.1 Zea mays clone pUT5525 MYB transcription factor (MYB23) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461087.10.0hypothetical protein SORBIDRAFT_02g040480
TrEMBLC5X3A00.0C5X3A0_SORBI; Putative uncharacterized protein Sb02g040480
STRINGSb02g040480.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-73myb domain protein 86